SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000028499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000028499
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily EF-hand 1.09e-17
Family S100 proteins 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000028499
Sequence length 98
Comment (Bos taurus)
Sequence
MAAEPLTELEAAIETVVTTFFTFAGREGRKGSLSVNEFKELVTQQLPHLLKDVGSLDEKM
KSLDVNQDSELKFSEYWRLIGELAKEIRKEKALEIRKK
Download sequence
Identical sequences L8HPQ9 P79342
ENSBTAP00000028499 ENSBTAP00000028499 XP_005203680.1.76553 XP_005203681.1.76553 XP_005910075.1.15283 XP_006040009.1.26621 XP_006041106.1.26621 XP_006041107.1.26621 XP_010836711.1.44457 XP_010836712.1.44457 XP_014338537.1.15283 XP_019810802.1.53367 XP_019810809.1.53367 9913.ENSBTAP00000028499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]