SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000029042 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000029042
Domain Number 1 Region: 49-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.3e-40
Family SCAN domain 0.0000434
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 223-279
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000017
Family KRAB domain (Kruppel-associated box) 0.0084
Further Details:      
 
Domain Number 6 Region: 355-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000253
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000029042
Sequence length 563
Comment (Bos taurus)
Sequence
MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEEHMWGQDASLQESPPPDPEVFRQRFR
HFCYQNTFGPREALSRLKELCHQWLRPEIHTKEQILELLVLEQFLSILPRELQAWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLPHEPTQSHF
KHSSRKPRLLQPRALPATHVPAPHPEGAPRDQAMASALFSADSQAMVKIEDMAVSLILEE
WGCQNLARRNLNRDTRQENYGNVISQGCENRNENEESTSKAESAEDSASRGETAGKFQKD
VGEKREQQGRVVERQQRNPEEKAGKEKRDSGPATVKEKKPSTGERGPREKGKGLGRSFSL
SSNFTTTEEVPTGTKAHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHT
RERASEYSPASLDTFGAFLKTCV
Download sequence
Identical sequences E1BIL7
9913.ENSBTAP00000029042 NP_001192439.1.59421 NP_001192439.1.76553 XP_005893200.1.15283 XP_006053681.1.26621 XP_010817777.1.76553 XP_015315896.1.76553 ENSBTAP00000029042 ENSBTAP00000029042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]