SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000029400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000029400
Domain Number 1 Region: 1013-1117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-31
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Weak hits

Sequence:  9913.ENSBTAP00000029400
Domain Number - Region: 685-748
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0628
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000029400
Sequence length 1119
Comment (Bos taurus)
Sequence
MKKASRSVGSAPKVSGTSRVQAADKARPESSSSASAGSRPVKPGAAAALSKTKSSDDLLA
GMAGGVTVTNGVKGKKNACSSAAPAAPAPAVSATENRPRTGTGTSSSTKRSTCTGNKEPS
STRERLRERTRLNQSKKLPSAGQGANDVASAKRSRSRTAAECDVRMSKSKSDNQISDKAA
LEARVKDLLTLAKTKDVEILHLRSELRDMRAQLGISEDPLTEGAETSEEKEASTVHQPTD
VESTLLQLQEQNAAIREELNQLKNENRMLKDRLNALGFSLEQRLDHSEKLFGYQSLSPEI
TPGNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSLDNLDSECSEVYQPLTS
SDDALDAPSSSESEGLPSVERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATL
QELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYV
IDEDVKSGRYMELEQRYMDLAENSRFEREQLLGVQQHLSNTLKMAEQDNKEAQELIGALK
ERSHHMERAVESEQKGKAALAATLEELRATLASDQIEMNRLKAQLENEKQKVAELYSIHN
SGDKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDAIAKVEDEYRAFQGEA
KKQIEDLNVAVEKLRSELEERDTERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTV
KKLQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRL
HEAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPT
PTVKTLIKSFDSASQVPSPAAAAMPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPL
TALSDKRPNYGEIPVQEHLLRTSSTSRPASLPRVPAMESAKTLSVSRRSSEEMKRDVSAP
EGTSPAALMAMGATSPQLSLSSSPTASVTPTARSRIREERKDPLSALAREYGGSKRNALL
KWCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFTLAFQA
AESVGIKSTLDINEMVRTERPDWQNVMLYVTAIYKYFET
Download sequence
Identical sequences E1BJ04
NP_001192793.1.59421 NP_001192793.1.76553 XP_005218283.1.76553 XP_005218284.1.76553 ENSBTAP00000029400 9913.ENSBTAP00000029400 ENSBTAP00000029400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]