SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000034314 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000034314
Domain Number 1 Region: 43-323
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.62e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000034314
Sequence length 361
Comment (Bos taurus)
Sequence
VFGCIFGALVIVAVGGFIFWRRRRKGVKNNDVTFSQIKPKKSKLIKVENFEAYFKKQQAD
SNCGFAEEYEDLKLVGINLPKYAAELAENRGKNRYNNVLPYDVSRVKLSVQTHSTDDYIN
ANYMPGYHSKEDFIATQGPLPNTLKDFWRMVWEKNVYAVVMLTKCVEQGRTKCEEYWPSK
QAQDYGDITVAMTSEIVLPEWTIRDFTVKNTPTSESHPLRQFHFTSWPDHGVPDTTDLLI
NFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFVAIDRLIYQIENENTVDVYGIVYDLRM
HRPLMVQTEDQYVFLNQCVLDIIRSQKDSKVDLIYQNTTAMTIYENLSPITTFGKTNGYI
A
Download sequence
Identical sequences F1MM04
ENSBTAP00000034314 ENSBTAP00000034314 9913.ENSBTAP00000034314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]