SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000035646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000035646
Domain Number 1 Region: 156-319
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.93e-43
Family Dual specificity phosphatase-like 0.0000136
Further Details:      
 
Domain Number 2 Region: 332-466
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.39e-30
Family PLC-like (P variant) 0.0023
Further Details:      
 
Weak hits

Sequence:  9913.ENSBTAP00000035646
Domain Number - Region: 14-146
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0212
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000035646
Sequence length 467
Comment (Bos taurus)
Sequence
SKIKRIVYLIISSFTFRIFAILLIFLDMALIIKDVIFLSGTTQISLESRSVSFVIAFFFF
MDVSLRVFIEGIRPYFSDIFNSLDAAIIIVTLLVDITYLLYDSILAKIFPRLRIVLRPVR
LVILIRVFHLAYQKRHLEMLTRRMVSGNKRRYKKDGFDLDLTYVTERIIAMSFPSSGKQS
FYRNPIKEVVRFLDTKHPNHYQVYNLCSERAYDPKYFHHRVHRYLIDDHNVPSLSEMLAF
SMEVKEWMAQDKDNIIVVHCKGGKGRTGTMVCAYLLASEIFATAEDSLYYFGERRTDKST
SSKFQGIETPSQNRFVGYFAMVKNIYNLTLPPIKKLTIKKFVIYSIHGVGKGNGHDLKVQ
IIMQRKTVFFCSASKNCRIFHDAETDRVIILLSKCPPLYDEVKVRFFSSSALPKYYENCA
FFFWFHMSFIRNNRLYLSRSELDNPHKIKAWKAYSPQFAVEVYFDDI
Download sequence
Identical sequences F1MYA3
ENSBTAP00000035646 9913.ENSBTAP00000035646 ENSBTAP00000035646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]