SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000035880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000035880
Domain Number 1 Region: 636-782
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.28e-46
Family Toll/Interleukin receptor TIR domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 35-163,394-543
Classification Level Classification E-value
Superfamily L domain-like 1.29e-35
Family Ngr ectodomain-like 0.02
Further Details:      
 
Weak hits

Sequence:  9913.ENSBTAP00000035880
Domain Number - Region: 230-415
Classification Level Classification E-value
Superfamily L domain-like 0.000782
Family Internalin LRR domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000035880
Sequence length 793
Comment (Bos taurus)
Sequence
MIKDKESPIRSCHFVYIVALVFGTIIQFSDESEFVVDMSKTSLIHVPKDLPPKTKVLDLS
QNNISELHLSDISFLSGLRVLRLSHNRIQGLDISIFKFNHDLEYLDLSHNQLQKISCHPI
TTTLKHLDLSFNDFDALPICKEFGNLTQLNFLGLSATKLQQLDLLPIAHLHLSCILLDLE
DYMKENKKESLQILNTKKLHLVFHPNSFFSVQVDISANSLGCLQLTNIKLNDYNCQVLLK
FLSGLTGGPTLLNFTLNHMETTWKCLVKVFQFLWPKPIEYLNIYNLTIVESIDEEVFTYY
KTTLKALKIEHITNKVFIFSQTALYTVFSEMNILMLTISDTRFIHMLCPQEPSTFKFLNF
TQNSFTDSVFQNCDTLARLETLILQKNELKDLFKTSLMTKDMLSLETLDVSWNSLEYDRS
NGNCSWVGSIVVLNLSSNALTDSVFRCLPPRIKVLDLHNNRIRSIPKDVTGLETLQELNL
ASNSLAHLPGCGIFSSLSILIIDYNSISNPSADFFQSCQKIRSLKVGNNPFQCSCELRDF
IQSVGQVSSDVVEGWPESYKCDYPESYKGTPLKDFQVSELSCNTALLIVTIVVPGLVLAV
AVTVLCIYLDLPWYLRMVCQWTQTRRRARNVPLEELQRTLQFHAFISYSEHDSAWVKNEL
IPNLEKEDIRICLHERNFVAGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH
HNLFHEGSDNLILILLDPIPQYSIPSSYHKLRALMAQRTYLEWPKEKSKHGLFWANLRAS
INIKLMEKAAEIH
Download sequence
Identical sequences B5T278 F1MV95
ENSBTAP00000035880 9913.ENSBTAP00000035880 ENSBTAP00000035880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]