SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000039412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000039412
Domain Number 1 Region: 91-253
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-32
Family Dual specificity phosphatase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000039412
Sequence length 270
Comment (Bos taurus)
Sequence
MVWVPGAPGGPGDSPGAGPEVATLERPAPAGSSSLGAAAASPPPWPGPRSPASCPAVGGS
PLRRAGWAGMAAGTLLEAGLARVLYYPTLLYTVFRGKMPGRAHRDWYHRIDSTVLLGALP
LRSMTRRLVQDENVRGVITMNEEYETRFLCNSSKEWEKAGVEQLRLSTVDMTGVPTLANL
QKGVQFTIRHQSLGHSVYVHCKAGRSRSATMVAAYLIQVYHWTPEEAIRAITKIRSHIYI
RPGQLEVLKEFHKVTTAGAAKTEIHHTPLT
Download sequence
Identical sequences Q2NKZ7
9913.ENSBTAP00000039412 ENSBTAP00000039412 NP_001069821.1.59421 NP_001069821.1.76553 ENSBTAP00000039412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]