SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000039420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000039420
Domain Number 1 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 412-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-16
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000599
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 578-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000987
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 537-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000133
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  9913.ENSBTAP00000039420
Domain Number - Region: 464-487
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0301
Family Rad50 coiled-coil Zn hook 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000039420
Sequence length 719
Comment (Bos taurus)
Sequence
MEATEELLLGRGRLQLAPDPRLGPESGWSPPSEGCAPGLKDVPPGPTRAILALKSLPRGL
ALGPSLTAEQRLGVWCVGEPLQPGLLWGPLEEGSVSEQKGNGVEPKRKEDVSLGSWGDVC
ACEQSAGWTSFVQLGRLEGEGNVAPVRIGERLHLRVSRRVLPGFELRLWPQLPSEGPSPP
QPRLEEASSAAVVTEVESAVRQEVACPGEDAAEPCPDPGHQSPPSIQAESVVSPGLTPQT
QPPVPKENQPLGPLPADDSVDEEDPPQTQTPPEPQSSSAPQQGPARGEASSSSSDRAPQL
CAHLVKKLRSPSGQHPPRAKTSEPGAQATGEPQRPGFPARLRSPPGPAGGSPKQGRRYRC
GECGKAFLQLCHLKKHAFVHTGHKPFLCTECGKSYSSEESFRAHTLGHRGVRPFPCPQCD
KAYGTRRDLREHQVVHSGARPFTCEQCGKAFARRPSLRLHRKTHQAAAAPTPCPCPVCGR
PLASQGSLRNHMRLHTGEKPFPCPHCGRAFRQRGSLRGHLRLHTGERPYRCPHCADAFPQ
RPELRRHLISHTGEAHLCPVCGKALRDPHTLRAHERLHSGERPFPCPQCGRAYTLATKLR
RHLKSHLADKPHRCPTCGMGYALLQSLRRHQLSHQPGAPASLPCEPPATSEPTVVLLQDA
GSEGDGTPARDIFEVTISQSQEKCFVAPEEPGPAPGLVLIHKDLGFSTWAEVVEVETGS
Download sequence
Identical sequences E1BCQ9
ENSBTAP00000039420 9913.ENSBTAP00000039420 NP_001180086.1.59421 NP_001180086.1.76553 ENSBTAP00000039420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]