SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000040594 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000040594
Domain Number 1 Region: 20-200
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.38e-44
Family Dual specificity phosphatase-like 0.0000000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000040594
Sequence length 203
Comment (Bos taurus)
Sequence
MSGPFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNAIESTMLDEGEIRKCCQGR
SVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYF
EKAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGP
NDGFLAQLCQLNDRLVKEGKLKL
Download sequence
Identical sequences Q2T9T7
9913.ENSBTAP00000040594 ENSBTAP00000040594 NP_001069842.1.59421 NP_001069842.1.76553 ENSBTAP00000040594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]