SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000041263 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000041263
Domain Number 1 Region: 27-151
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-27
Family Dual specificity phosphatase-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000041263
Sequence length 167
Comment (Bos taurus)
Sequence
MKPPSSMQTSEFDSSDEEPIEDEQTPIQISWLPLSRVNCSQFLGLCALPGCKFKDVRRNI
QKDTDGGTPDITSCCEIMEELEICLKNNRKTLIHCYGGLGRSCLVAACLLLYLSDTVSPQ
QAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRNSLSRSVSR
Download sequence
Identical sequences Q32PC4
ENSBTAP00000041263 9913.ENSBTAP00000041263 ENSBTAP00000041263 NP_001035672.1.59421 NP_001035672.1.76553 XP_005968704.1.78601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]