SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000041997 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000041997
Domain Number 1 Region: 53-307
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.86e-30
Family G proteins 0.047
Further Details:      
 
Domain Number 2 Region: 443-531
Classification Level Classification E-value
Superfamily EF-hand 7.8e-23
Family Eps15 homology domain (EH domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000041997
Sequence length 535
Comment (Bos taurus)
Sequence
MFSWLRSDDRRRKDPEVFQTVSDGLKKLYRTKLLPLEEHYRFHEFHSPALEDADFDNKPM
VLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGEMEGIIPGNALVVDPKK
PFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAE
RVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSL
GKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKR
ARLAKVHAYIISSLKKEMPSMFGKDNKKKELVNNLAEIYGQIEREHQISPGDFPALKRMQ
DQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEETQRPAQIVKGGAFEGTLHG
PFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSV
LGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPNELPAHLVPPSKRKATE
Download sequence
Identical sequences A5D7E1
ENSBTAP00000041997 9913.ENSBTAP00000041997 ENSBTAP00000041997 NP_001091473.1.59421 NP_001091473.1.76553 XP_005893666.1.15283 XP_010843588.1.44457 XP_019826033.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]