SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000046266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9913.ENSBTAP00000046266
Domain Number - Region: 55-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000293
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000046266
Sequence length 352
Comment (Bos taurus)
Sequence
MAAAGPRGGLLTQPAAARPKTRSVLPCQAAPNGQKPKKCLVYPHPPKSSRLSRSVLRWLQ
SLDLTFFPRNISRDFSNGFLIAEIFTTYYPWDLKLSSFKNGTSLKVKLDNWAQLEKFLAR
KKLKLPKELIHGTIHCKAGVPEILIQEVYTLLTHREIKSIQEDLVNFTDYSYQMQLPLVP
RSTASKSIKDNIRLSELIGNPNKLNNELKVEFLFLLQMLQRKLSRKLNPKWFAVKPTVGE
STLDHRPAKASGNKSNSVVSKERPVPVCCAASVSTSRAKKQSKQGKPPSQGAPTFFYMSH
PNTDFCLKKKLSRLRGNRVSTPKEIEVKQTRTYSDCMKPTINVEKEPEEAPV
Download sequence
Identical sequences Q3SZH4
9913.ENSBTAP00000046266 ENSBTAP00000046266 XP_005226001.1.76553 ENSBTAP00000018797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]