SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000046639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000046639
Domain Number 1 Region: 386-525
Classification Level Classification E-value
Superfamily EF-hand 2.07e-20
Family Calmodulin-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000046639
Sequence length 548
Comment (Bos taurus)
Sequence
RVPQLDLGSLVDSDEEDDLPYMPLSTEHIHFNPTNSSFGFGWVTPCHKLYTQHHLYDLFL
EQDRIPENLPAPTDKYKLKHQQYKTEMTGGYKQYSQRNAEKAKSTNFPDSNRFVENGFYY
DLTTLDRKALLQLGYAANPHILQRSTGKSDADVVAAEKKKQMVAEQVMIDHLSRAVISDP
EQNLTSEKPEISHILPDSKLAPIRFRKRTLHETKIRTQSTLTENILSHKVQFDGRIISRN
GRDACRELVGFFFTHDQSLTIYEYRQFGKNRTNVLPFIQKNIYCHQRGRRKGKQYRLADL
YVGANLTFLSSDHPRLPESVKENTVLTLRITNVDWRALDSLKTDSEEHDDVTSEEANDRK
ILKAIQDLLKEQLRRRGVRILTGLGKHLQQLDKEGNGLLDKADFKQALKLFRLEVSENDF
ESFWLILNSSGNGRADYGEFKRAIIGEMNEYRKSFVRKAFMKLDFNKTGSVSIIDIRKCY
CAKMHPRVISGHSTEEEIKSSFLETLKDACSKSDEVSYGEFEDYYEGLSIGIVDDEDFVN
VLCTPWGI
Download sequence
Identical sequences F1MD06
ENSBTAP00000046639 ENSBTAP00000046639 9913.ENSBTAP00000046639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]