SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000048819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000048819
Domain Number 1 Region: 144-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.77e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 268-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-22
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 229-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.3e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 107-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000048819
Sequence length 331
Comment (Bos taurus)
Sequence
IIKNYMVLVRKGLIVSKPDLVTFLEKMRDPQNVRRMETTAIHPDLASFRPAVSRLSSISS
VLQGMVTMHGDCKGNSRRESLGAPRKVSDPSSDLTRQQRIQNPRKENKCNICGKVFTNSS
YLSRHRKIHSGRKPFKCTECGKGFMRGTDLTQHQRIHTGQKPYKCKVCDKAFNCSSSLTR
HQRVHTEEKPYKCTKCGKAFKQNSSLNHHQRLHTGKSNQFNKCSEVITCCSSLTEHQVIH
SREKPYKCKDCGKGFIKITSLIPHRRIHTGEKPYKCKECGKAFTQSSSLTQHQRIHTGEK
PYICKECGKAFRQSSSFHKHQRIHTEKKPYK
Download sequence
Identical sequences F1MQY7
9913.ENSBTAP00000048819 ENSBTAP00000048819 ENSBTAP00000048819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]