SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000052557 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000052557
Domain Number 1 Region: 23-168
Classification Level Classification E-value
Superfamily EF-hand 8.33e-49
Family Calmodulin-like 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000052557
Sequence length 172
Comment (Bos taurus)
Sequence
MASSYRKPTVASTSQKRKVGPKPELTEEQKQEVREAFDLFDADGSGTIDVKELKVAMRAL
GFEPRKEEMKRMIADVDKEGTGKISFNDFLAVMTQKMAEKDTKEEILKAFRLFDDDETGK
ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEDEFLRIMKKTNLY
Download sequence
Identical sequences L8IF28 Q32LE3
ENSBTAP00000052557 ENSBTAP00000052557 9913.ENSBTAP00000052557 NP_001072974.1.59421 NP_001072974.1.76553 XP_005898952.1.15283 XP_010827204.1.44457 XP_019842035.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]