SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000053032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000053032
Domain Number 1 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.95e-27
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 299-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 93-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000053032
Sequence length 358
Comment (Bos taurus)
Sequence
MESLQGNTAQHPMDEKACKSEGQLSRQTKCPVQKKSSFEKTAIRKVSVSLKEIFAKEKGP
EYSKFNLSSNFNTRQRIPKGARSPKSRKNSKDNSDLIKHQKLFLQRKPCKCNECGKAFNY
ESDLIVHRRIHGGEKPFECNECGKTFSRSTHLIEHQRTHTGEKPYECPECGKAFSRSTHL
SLHQRIHTGEKPYECSECGKAFSRSTNLSQHQRTHTQEKPYKCNECGKAFSDRSTIIQHQ
RIHTGENPYECSECGKAYSWISSLIEHQRTHSGENPYECNDCGKVFSRSSSLAEHQRIHT
GEKPHECRVCGKGFSRSSSLIIHQRTHTREKPFKCNSCEKAFSQSSTLIRHQQLHTKE
Download sequence
Identical sequences A6QPV7
9913.ENSBTAP00000053032 ENSBTAP00000053032 NP_001093822.1.59421 NP_001093822.1.76553 XP_005223779.1.76553 XP_010816732.1.76553 XP_019840837.1.53367 XP_019840838.1.53367 ENSBTAP00000012058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]