SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000053402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000053402
Domain Number 1 Region: 199-577
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 4.91e-100
Family Phosphonoacetate hydrolase 0.02
Further Details:      
 
Domain Number 2 Region: 657-911
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.41e-26
Family DNA/RNA non-specific endonuclease 0.012
Further Details:      
 
Domain Number 3 Region: 105-150
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000641
Family Somatomedin B domain 0.002
Further Details:      
 
Domain Number 4 Region: 151-191
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000549
Family Somatomedin B domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000053402
Sequence length 924
Comment (Bos taurus)
Sequence
MERDSCAGGGSRGGEGGRGPREGLAGNGRDPGPGRAAEASGEPQAAASLLAPMDLGEEPL
ERAARARPAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEIKSCKGRCFERTFGNC
RCDAACVDLGNCCLDYQETCIEPERIWTCTKFRCGEKRLSRSLCSCSDDCKDKGDCCINH
GSVCRGEKSWAEEECDSIDEPQCPAGFETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKT
CGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNNIYDPQMNANFALKNKEKFNPEW
YKGEPIWLTAKYQGLKTGTFFWPGSDVKINGIFPDIYKIYNVSVPFEERILAILKWLQLP
KDERPHFYTLYLEEPDSSGHSYGPVSSEVIRALQRVDNMVGMLMDGLKELNLHRCLNLIL
ISDHGMEQGSCKKYVYLNKYLGDTKDYKVVYGPAARLRPSDVPDKYYSFDYEGIAKNLSC
QEPNQHFKPYLKHFLPKRLHFAKNDRIERLTFYLDPQWQLALNPSERKYCGGGFHGSDNT
FLNMQALFIGYGPGFKHSTEVDSFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLSNPVY
TPKHPKEVRPLVQCPFTRAPRESLDCSCDPSILPIVDFQTQLNLTMAEEKTIKRGALPYG
RPRVLQNSTVCLLYQHQFVSGYSRDILMPLWTSYTIGRNDSFSTEDFSNCLYQDLRIPLS
PVHKCSFYKNNAKLSYGLLSPPQLHKGSSQVYSEALLTTNIVPMYQSFQVIWHYLHGTLL
QRYAEERNGLNVVSGPVFDSDYDGRYDSLETLKQNSKIIRNLEVLIPTHFFLVLTSCKNT
SQTPLQCENLDAMAFILPHKTDNSESCAHGKHESLWVEELLKLHTARITDVEHITGLSFY
QERKEPISDILKLKTHLPTFNQED
Download sequence
Identical sequences F1MNS5
ENSBTAP00000053402 NP_001193141.1.59421 NP_001193141.1.76553 ENSBTAP00000053402 9913.ENSBTAP00000053402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]