SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000053455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000053455
Domain Number 1 Region: 35-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.84e-37
Family SCAN domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 441-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 482-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 347-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-19
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 6 Region: 224-258
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000183
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000053455
Sequence length 543
Comment (Bos taurus)
Sequence
MLVERPGMAEEPQQQMGGHVVKLEKELPWGRTREDPSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRQWLRPELHTKEQILELLVLEQFLTILPREFYAWIWEHGPESGKALVAMVEDF
TQRALEAKAVPCHVQGQREETTLCRDPWEPSVHLGPVEVKPEWGMPHGEGIQDLDRGTEE
QLSQDPGEGMQAFQEQALPVLQAGAGLPAVSTRDQEVAASFLTAGSQGLGPFKDMALAFP
EEEWRHVTPAQIDCFGEYVEPQDCGVSPPGLGSKDKEAKTQLADPKGQLACGRAERCGEA
ALQGPESGRPSEQQAGSSVGNAPGPLLPQHSVAPLPDDLQTHSSFWKPFQCPECGKGFSR
SSNLVRHQRTHEEEKSYSCGECGKGFALREYLLKHQRTHLGRRPHVCSECWKTFSQRHHL
AVHQRSHTGEKPFQCADCWRSFSRRQHLQVHRRTHTGEKPYTCECGKRFSRNANLAVHRR
THTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYRCPACGRSFNQRSILNRHQKTQHR
QEP
Download sequence
Identical sequences 9913.ENSBTAP00000053455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]