SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000002832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000002832
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily NTF2-like 3.41e-36
Family NTF2-like 0.0029
Further Details:      
 
Domain Number 2 Region: 327-438
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.73e-19
Family Canonical RBD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000002832
Sequence length 482
Comment (Oryctolagus cuniculus)
Sequence
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQND
IHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSV
PNKFYVHNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHP
VTNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKNLEELEEKSTTPPPAEPVSLPQEP
PKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRVEAKPEVQSQPPRVREQRPRERP
GFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDIDENELKEFFMSFGNVVEL
RINTKGVGGKLPNFGFVVFDDSEPVQRILIAKPIMFRGEVRLNVEEKKTRAARERETRGG
GDDRRDIRRNDRGPGGPRGIVGGGMMRDRDGRGPPPRGGMAQKLGSGRGTGQMEGRFTGQ
RR
Download sequence
Identical sequences A0A024RDE5 A0A2I3LYY9 A0A2J8UU46 A0A2K5JB39 A0A2K5L6E6 A0A2K5XW05 G1SJC7 G3RG46 G7P563 H2R0J3 Q5R9L3 Q9UN86
HR6389 gi|19923399|ref|NP_036429.2| gi|45359849|ref|NP_987101.1| ENSGGOP00000014586 ENSPPYP00000016578 ENSPTRP00000040810 ENSGGOP00000014586 ENSP00000352738 ENSP00000379069 9598.ENSPTRP00000040810 9600.ENSPPYP00000016578 9606.ENSP00000352738 9986.ENSOCUP00000002832 ENSPTRP00000040810 ENSPPYP00000016578 ENSP00000352738 ENSP00000379069 ENSOCUP00000002832 ENSP00000350518 ENSOCUP00000002832 NP_036429.2.87134 NP_036429.2.92137 NP_987101.1.87134 NP_987101.1.92137 XP_003310384.1.37143 XP_003832360.1.60992 XP_003832361.1.60992 XP_004038891.1.27298 XP_005263439.1.92137 XP_005263440.1.92137 XP_005555089.1.63531 XP_005555090.1.63531 XP_005555091.1.63531 XP_005555093.1.63531 XP_007997109.1.81039 XP_007997110.1.81039 XP_007997111.1.81039 XP_007997113.1.81039 XP_008265953.1.1745 XP_009238363.1.23681 XP_009238364.1.23681 XP_009238366.1.23681 XP_011530743.1.92137 XP_011782591.1.43180 XP_011782592.1.43180 XP_011821570.1.47321 XP_011821571.1.47321 XP_011821572.1.47321 XP_011895796.1.92194 XP_011895797.1.92194 XP_011895798.1.92194 XP_011895799.1.92194 XP_015305879.1.63531 XP_016864365.1.92137 XP_016864366.1.92137 XP_018880876.1.27298 XP_517219.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]