SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000003178 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000003178
Domain Number 1 Region: 33-503
Classification Level Classification E-value
Superfamily Sema domain 3.4e-111
Family Sema domain 0.000026
Further Details:      
 
Domain Number 2 Region: 1347-1473,1668-1819
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-43
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 1036-1140
Classification Level Classification E-value
Superfamily E set domains 7.7e-17
Family E-set domains of sugar-utilizing enzymes 0.07
Further Details:      
 
Domain Number 4 Region: 949-1037
Classification Level Classification E-value
Superfamily E set domains 9.67e-16
Family Other IPT/TIG domains 0.027
Further Details:      
 
Domain Number 5 Region: 852-950
Classification Level Classification E-value
Superfamily E set domains 0.000000000000026
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 503-548
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000131
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 1137-1227
Classification Level Classification E-value
Superfamily E set domains 0.000000434
Family E-set domains of sugar-utilizing enzymes 0.038
Further Details:      
 
Domain Number 8 Region: 805-837
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000301
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000003178
Sequence length 1874
Comment (Oryctolagus cuniculus)
Sequence
MPLPPLSPCVLPAVQVAAGTPRPGGGPQPAFRTFVASDWGLTHLVVHEQTGEVYVGAVNR
IYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDYAADRLLAC
GSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVREAGSMAGVLIAGPPGQGQAKLFVGTP
IDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSF
RSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPIGCEQAGVEYR
LVQDAYLSRPGRALARQLGLAEDEDVLFTVFAQGQKNRVKPPKESALCLFTLRAIKEKIK
ERIQSCYRGEGKLSLPWLLNKELGCINSVSFVCGFFCLFCPDPLGGLGEGLWPCLAGGRT
DGCAATAGQCLGQHHVAAGGGQGGRPLPPQILVDLSNPGGRPALAYESVVAQEGSPILRD
LVLSPNRQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSVCSRQDACER
ADEPQRFASDLLQCVQLTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVNCSFEDFTESEGL
LEDGRIHCRSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLS
CVNGSFPCHWCKYRHVCTHNAADCAFLEGRVNMSEDCPQILPSTQIYVPVGVVKPITLAA
RNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDISDLPVNLSVV
WNGNFVIDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLRHHCPADSPA
AWMHARHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVRVGKVLCSP
VESEYISAEQIVCEIGDASTVRSHDALVEVCVRDCSPHYRALSPKRFTFVTPTFYRVSPS
RGPLSGGTWIGIEGSHLNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQNPGSAPIVIN
INRAQLSNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLGTVREPRIRAKYGGVE
RENSCMVYNDTTMVCRAPSVDNPTRSPPELGERPDELGFIMDNVRALLVLNSSSFVYYPD
PVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCILTVSETQLLCE
SPNLTGQHKVTVRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVIVAVLIAYKR
KSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAM
RVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNV
ASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRNKTFNKKKSYGWTLLLV
AKFANECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVI
PENENAPEVPVKGLNCDTVTQVKEKLLDAVYKGVPYSQRPKAGDMDLEWRQGRMARIILQ
DEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYESMLRT
ASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYLTRLLATKGT
LQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDADVRHTWKSNCLPLRF
WVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNY
KSWVERYYADIAKMGPVSHAEAVTRPRKWAAGLAHGAPSPALQILAALEKDEQARRQRLR
SKLEQVVDTMALSS
Download sequence
Identical sequences G1SK61
9986.ENSOCUP00000003178 ENSOCUP00000003178 ENSOCUP00000003178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]