SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000003433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000003433
Domain Number 1 Region: 156-261
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 2 Region: 263-367
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 
Domain Number 3 Region: 49-153
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 4 Region: 915-1010
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 474-579
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00048
Further Details:      
 
Domain Number 6 Region: 579-686
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.001
Further Details:      
 
Domain Number 7 Region: 370-475
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 8 Region: 807-914
Classification Level Classification E-value
Superfamily SRCR-like 1.14e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000003433
Sequence length 1140
Comment (Oryctolagus cuniculus)
Sequence
MDKLRMILLEDSGPIDFRRDFVHLHPFTIALVSLLSASFIASSLGGTEKQLRLMAGENNC
SGRVEVKVQEEWGTVCNNDWSMEEVSVICRQLGCPTAIKAPSWANSSAGSGRIWMDHVSC
RGNELALWDCKHEGWGKHNCTHQQDAGVTCSDGSDLEMRLMNGGNRCSGRIEVKFQGQWG
TVCDDNFNIDHATVVCKQLECGSVISFLVSAKFGEGSGPIWFDDLVCSGNESALWNCKHR
GWGTHNCDHAEDAGVICSDGADLSLRLVDGVTECSGRLEVKFQGEWGTICDDGWDKKDAA
VACKQLGCPTAITAIGRVNASEGSGHIWLDSVSCNGYESDLWHCKHQDWGKHYCSHHEDA
GVTCSDGSDLKLRLVGGGSRCAGTVEVEIQKLLGKVCNKGWTMEKANVVCRQLGCGSALK
TSYQVYSKIKATNTWLFASSCIGNESSLWDCNNWQWGGLPCDPEEEAQVTCSGHREPRLA
GGDIPCSGRVEVKHGDKWGSVCDSDFSLEAANVLCRELQCGTAISILGGAHFGEGNGQIW
AEEYLCEGNEMHLSLCPVALRTDGTCNHSRDIGVVCSRYAEVRLVNGKSSCEGRVELKVL
GTWGALCNSHWDIEDAHVLCQQLKCGVALSIPGGAHFGKGSGQVWRHMFHCSGMEQHIGD
CPVTALGASLCTAGQVASVICSGNQSQTLAPCNLSSLAPTSSTSPKDSAVACIEREESRN
KLIYQENNTKGNNEILYKDLMKVLCNYSINLKTCHSTKKNVLCGDALEKTILQLSKLGKQ
KSSREHAQQNCEVSDDVKPLLLCFTPEFMSLRLTSENSRETCRGRLEVFYNGAWGSVGRN
NMSSTTVGVVCRQLGCADKGNVNPASSDKTPSRHMWVDNIQCPKGPATLWECPSSPWKQR
VASPSEETWITCENKIRLQEGPNNCSGRVEVWHGGFWGTVCDDSWDIVDAQVVCRQLGCG
EAFEAIKEAGFGLGTGPIWLNEVKCKGNESSLWECPAGPWGHSDCWHKGRCSCKMPPRIF
RYQRTTEKHSLGHPFLIAFGILGIILLAVLIAFLLRTQNRKQIQLLTVFSRGEHLVHHVQ
YQEMNSGTNADDLDLLTSSENFNESYGFNASVLISVSKYLPVFGMKGATLKDTEEKNENL
Download sequence
Identical sequences G1SKS7
ENSOCUP00000003433 ENSOCUP00000003433 9986.ENSOCUP00000003433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]