SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000003436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000003436
Domain Number 1 Region: 23-404
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000628
Further Details:      
 
Domain Number 2 Region: 381-505
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 8.93e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000003436
Sequence length 511
Comment (Oryctolagus cuniculus)
Sequence
LQAYQEGTLQKLLKMNGSEDLPPSYDYDLIIIGGGSGGLAAAKEAAKYGKKVMVLDFVTP
TPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKFEDTVEHDWEKMTEAVQ
NHIGSLNWGYRVALREKKVVYENAYGEFIGPHQIKATNNKGKEKIYSAERFLIATGERPR
YLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLR
GFDQDMANKIGAHMEEHGVKFIRQFVPIKVEQIEAGTPGRLRVVAKSTNSEETIEGEYNT
VLLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVA
IQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENVEVYHSFF
WPLEWTIPSRDNNRCYAKIVCNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKTQLD
STIGIHPVCAEVFTTLSVTKRSGGDILQAGC
Download sequence
Identical sequences 9986.ENSOCUP00000003436 ENSOCUP00000003436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]