SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000004032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000004032
Domain Number 1 Region: 870-1081
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-54
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 1244-1430
Classification Level Classification E-value
Superfamily PH domain-like 3.63e-26
Family Pleckstrin-homology domain (PH domain) 0.00000854
Further Details:      
 
Domain Number 3 Region: 1070-1191
Classification Level Classification E-value
Superfamily PH domain-like 2.04e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000004032
Sequence length 1434
Comment (Oryctolagus cuniculus)
Sequence
VFVFLEIKKPPVAPKPKFVVANNKPAPPPIAPKPDIVVSSVPQSTKKTKPAIAPKPKVLK
SSPVRDIGKLPSKKITVSLEERKQELPGSTDNFNGKKGERQSSDCILPVCSCSSECNHKL
GTGENMCLEELVLEPMEMTGSLENNKIAESSLAIKTWGKCDSHSEKIKSQSGVVLKASIL
DEKLRDVLTQGASPFSSPRQHRSRGNPEMNGGCHSGRQLEIEFADLSPPQSSLEKISDHY
NCYQQLPRGELQTIESCQQGSEKSNSYFHSSELEALEDGKSIFTSSDGLSKKSEVSDFGP
LEIHLVPCTPKFPTPKPRKTRTARLLRQKYVDTPSESTEEPETADGSCACFTEDSLKNDQ
SSVLHQDVVCNQEQVDKIKPGNESELNRSFNNDRQDLVNSHKDMHHETPSSEKLAPVLDT
NSNLSSDSMTVDGSSTSPAGDRGTSFIRCSAVSMSLPKQLKLTCNEHLPTACDLGVSAPP
MQKESVMKEGSSLRVVPKKPQRHSLPAAGVLKKAASEELVEKSSYSSAEKNSEKDLERNH
LQHLCAPNHGMSPSFDMPKRTSEKPVWKLPHPILPFLGNPESLKSITIPPNCEPSTALTK
PRAKSLSAVDMERCNKPCKDSSKKNSLKKLLNMKLSICFTKNDFQKFWSKSSQLGDTMAG
SLSGGERKGIIKESDWHGLSVEEKRSKPIKAYSADNYSLECQKKRKKSRGQISAANGPRA
ESLDDQMLSRESLSQVPCKSATSGCAPEYENVRHYEEIPEYENLPFVMAVGKAPELGWQN
SSSMEDADANVYEVEEPYEAPDGRLQPGPRQQHSSSSGAAQEGQSDLDLGPGDLPSDEEE
VINSSDEDDVSSGSSRGEPDLLEDKQDEDTGMKSKVHHIAKEIISSEKVFVDVLKLLHID
FRNAVAHASRQLGKAVIEDRILNQILYYLPQLYELNRDLLKELEERMLNWTEQQRIADIF
VKKGPYLKMYSTYIKEFDKNIALLDEQCKKNPGFATVVREFEMSPRCANLAVKHYLLKPV
QRIPQYRLLLTDYLKNLLEDSGDYRDTQEALAVVIEVANHANDTMKQGDNFQKLMQIQYS
LNGHHEIVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLA
GMKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISRSIEEYAKKRTTFCPSR
SLEEADSENKEEVTPLGSKAPIWIPDTRATMCMVCTSEFTLTWRRHHCRACGKIVCQACS
SNKYGLDYLKNQPARVCEHCFQELQKLDHQHAPKIGFPGNHKSPSSALSSVLHSIPSGRK
QKKIPAALKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALES
QPLLGFTVTQVKDEHSESKVFQLLHKNMLFYVFKADDAHSAQKWIEAFQEGTVL
Download sequence
Identical sequences G1SMA0
ENSOCUP00000004032 9986.ENSOCUP00000004032 ENSOCUP00000004032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]