SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000004286 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000004286
Domain Number 1 Region: 587-767
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-63
Family SPRY domain 0.00000597
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily DEATH domain 2.24e-24
Family Pyrin domain, PYD 0.0036
Further Details:      
 
Domain Number 3 Region: 363-424
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000351
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  9986.ENSOCUP00000004286
Domain Number - Region: 297-357
Classification Level Classification E-value
Superfamily RING/U-box 0.00789
Family RING finger domain, C3HC4 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000004286
Sequence length 773
Comment (Oryctolagus cuniculus)
Sequence
MAKTPSDHLLNTLEELVPYDFEKFKFKLQNTSLEKEHSRIPRGQLQMARPVRLATLLVTH
YGEEHAVRLTLQVLRAINQRLLAEELHRATEQASSNQDSCRFPSSVQDLLGKCPAAGRAP
GSPKAAEGPEGEGQRQSGDGAASSPSGQPEAGRGPQKKPQVKRREPKCLGVDAQGRPGAR
RSPVLGRPPGDRPGPTSARLRRNASSAGRLQGQCGAYPGKTEQKKLEVYLPSGKKRPKSL
ELISSRDREPPNPGTLLPQEEAGTRKPASAATPRGAATHDAEAAQALEKSSRNPDHSLAR
RPQDKAACPLCHTQEGDPVGTTCRRDSCSCPVAPAHPRASGGRLPGCPHCQVSLAWKSSR
GLSPPPLPHCQRHMKQLLFCEDHGEPTCLICSLSQEHRGHRVRPIEEVALEYREQIQKQL
EHLKQLRRCGEERRSQGDEKMEKFLKQTETQRQRVCCQLEQLFQFLEEQEQLFVAWLEEL
GQTIGQVREKYGTRVSWNIALLDELIGELEAKQCKSEWELMQDIGVTLHRAKAVTVPEPW
ATPPEVKEKIQLLYQKSEFIEKSMESFSETLRSEMETFNVPELISAQAHAVNVTLDAETS
HPNLIFSDDLKSMRLGNKWERLPEEPERFDSCIIALGSPSFLSGRHYWEVEVGDKTAWIL
GVCKASMSRKGSMILSPENGYWVVMMKQNEYRVSTFPPTRLWMRELPRRVGIFLDYKTRN
ISFYNVTARSHMYTFTSFSSSGPLQPIFSPGAHDRGKNMGPLTICPVGDQRLR
Download sequence
Identical sequences 9986.ENSOCUP00000004286 ENSOCUP00000004286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]