SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000004379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000004379
Domain Number 1 Region: 33-209
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.49e-60
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000004379
Sequence length 221
Comment (Oryctolagus cuniculus)
Sequence
MEPEPTRLPESGAPRPPVEPRTSCPVTEPSEERKFRVLVGVTGSVAALKLPLLVSRLLDV
PGLEVAVVTTERAKHFYSPQDVAVTLYSDADEWEMWKQRCDPVLHIDLRRWADLMLVAPL
DANTLGKVASGICDNLLTCVIRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYIE
IPCVAKKLVCGDQGLGAMAEVETIVDKVREILSQHDGVQHG
Download sequence
Identical sequences G1SN42
XP_008247429.1.1745 XP_008247431.1.1745 XP_008247432.1.1745 ENSOCUP00000004379 9986.ENSOCUP00000004379 ENSOCUP00000004379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]