SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000004486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000004486
Domain Number 1 Region: 2-232
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.51e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0023
Further Details:      
 
Domain Number 2 Region: 313-487
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000505
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000004486
Sequence length 536
Comment (Oryctolagus cuniculus)
Sequence
TMAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGLWRFKENVEDGRASIYQSVI
TNTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVISVKKRPDF
SSSGQWEVVTQSNSKEQSAVFDAVMVCSGHHILPNIPLKSFPGIEKFKGQYFHSRQYKHP
AGLEGKRILVIGIGNSASDIAVELSKKAAQVYISTRKGSWVMSRISEDGYPWDMVFHTRF
SSMLRNVLPRMIVKWMMEQQMNRWFNHENYGLAPENKYLMKEPVLNDDLPSRILYGTIKV
KRRVKELTESAAIFEDGTVEEDIDVIVFATGYTFAFPFLEESLVKIEDNMVSLYKYMFPP
QLEKSTFACLGLIQPLGSIFPTVELQARWATRVFKGLCSLPSKETMMADIIKRNENRIAL
FGESLSQKLQTNYIDYLDELALEIGAKPDLVSFLFKDPKLAVKLYFGPCNSYQYRLVGPG
QWEGARNAIFTQKQRILKPLKTRTLKASSNFPVSFLLKFLGLFALVLAFLFQLQWF
Download sequence
Identical sequences G1SND1
ENSOCUP00000004486 9986.ENSOCUP00000004486 ENSOCUP00000004486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]