SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000006026 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000006026
Domain Number 1 Region: 881-1102
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.2e-38
Family DBL homology domain (DH-domain) 0.0024
Further Details:      
 
Domain Number 2 Region: 1258-1458
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-31
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 1089-1206
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-23
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000006026
Sequence length 1460
Comment (Oryctolagus cuniculus)
Sequence
MSRGPKPPIAPKPRLAVPSEWRASVSVNNSFNKCSNGRLLCVDKGLYEGHRPNLECSESE
TDEDYIMAPRAPRKEDEPKDGPCGENTVTGPQDATSEEVGEEGVEESGRERTAAGKDLAP
PAAPAGGAPGEEDEEGADCTPENGDSDSDPGAREQESTSEEEKLVKEHSVYHREDSGPLA
AQEAVGSDVILTQLGSEDPAAPDEEPRPPETPGELAEEEGVGCAGAEPGGPGEDTDQGAE
DASEGPPEDELATGVQEAEMAAENPEIPEEECDGVPAAEDPVGQDEKTEQEEMAAAPAEA
EDPREGEDPAQDEAPEESCHIIPFESDCVDDAVTSLTGSPYKFFQTESTSFCSESCSPLS
ESAEGLESEQEARSGACAEEGPVAGTVCDQSNPLQGAAGEGGSSVPEVVVMPEEEAEEGA
TDDALTNPYVMGVSLTGQADPAEGGQAETSADLDTLSDCGLREEVNADAEGGLVPTDRKN
LVTRARPHSGKVAGSVPETVPEETGPEAGSLASGTAGSPEQAGKMVLSSEGKAGEANRAL
PAKPRAFTLYPRSFSVEGREIPISVYREPEGLDDHRINRKDDNLSLPCVIGSSGSFSQRN
HFPSSGTSTPSSVVDIPPPFDLACITKKPITKSSPSLLIESDSPDKHTKKKKSSFKRFLA
LTFKKKTENKVHVDVNVSSSRSSSESSYHGPARILELNPRSLSSSPQLKTRTGKLRASDS
PSSLIFCRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIP
AMNSDYENIQIPPRRPARAGTYTKLFEDQSRALSTANENDGYVDMSSFNAFESKQPSAEQ
EAESAYTEPYKVCPISAMAPREDLTSEEEQRSSEDEESAPSLTHKVEGQSRALVIAQELL
SSEKAYVEMLQHLHLDFHGAVTRALDDMDPEGRDPLAHEELRQGLDELPAILDLHQGILE
ELQERLSEWEGQQKVADVFLTREQGFEHHTAHILQFDRYLALLAESCLRSPQLAAAVREF
EQSAQGSSQGVKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQAVLTLISKVTDRA
NDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFVKEGTLLKVTGRSRHPRHLFLMSDMLL
YTYPLKDGKYRLKSSLPVAGMKVSRPVTEKVPYALKMETRDSSLLLFASSCAERDEWYGC
LSRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRR
HHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGGPVPGLLRERPVSMSFP
LSSPRFSGSAFSSVFQGINPAAFKKQKKVPSALTEVAASGEGSAISGYLSRSKKGKRHWK
KLWFVIKGKVLYTYMASEDKAAMESMPLLGFTITPEKEGSSEAGPVFHLYHKKTLFYSFK
AEDPSAAQRWIEAMEDASVL
Download sequence
Identical sequences G1SS38
ENSOCUP00000006026 ENSOCUP00000006026 9986.ENSOCUP00000006026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]