SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000006661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000006661
Domain Number 1 Region: 10-180,282-386
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.1e-49
Family FAD-linked reductases, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000006661
Sequence length 486
Comment (Oryctolagus cuniculus)
Sequence
MDSSDCHRKKVAVIGGGLVGSLNACFLAKRNFQVDVYEAREDIRVAKFARGRSINLALSY
RGRQALKAIGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSISRENLNKDLLN
AVEKYSNAKVHFGHRLLKCNPEEGTITVLGPDNVPKDVTCDLTVGCDGAYSTVRTHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTGSDVLDFFQKHFPDSIPLIGAQALAHDYFLLPAQPMISIKCSSFHFKSHCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMEKFNNDLSICLPEFSRFRIPDDHAISDLS
MYNYIEMRAHVNSRWFIFQKNIERVLHCIMPSTFIPLYTMVTFSRIRYHEAVLRWHWQKK
VINRGLFFFGSLIAIGGYYLLVHYMSLRPLDYLRRPWNWITYFQNPPCVSGEGISTFTQS
SNLLSR
Download sequence
Identical sequences ENSOCUP00000006661 9986.ENSOCUP00000006661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]