SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000006765 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000006765
Domain Number 1 Region: 344-690
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.7e-40
Family Hect, E3 ligase catalytic domain 0.0095
Further Details:      
 
Domain Number 2 Region: 210-292
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.2e-28
Family PHD domain 0.00062
Further Details:      
 
Weak hits

Sequence:  9986.ENSOCUP00000006765
Domain Number - Region: 138-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.012
Family PHD domain 0.029
Further Details:      
 
Domain Number - Region: 68-106
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0276
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000006765
Sequence length 705
Comment (Oryctolagus cuniculus)
Sequence
MNENKPDDSRNLACVFCRKNDDCPSKYGEKKTNEKWNLTVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVNRASKLKCCVCKKTGASIGCVAPRCKRSYHFPCGLQGECIFQFTGNF
ASFCWKHRPVQIITSNNYRDSLPCTICLEFIEPVPTYSILRSPCCKNAWFHRDCLQAQAI
NAGVFFFRCTICNNSDIFQKEMLRMGIHIPEKDASWELEENAYQELLQHYEHCDVRRCRC
KEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRSIIYNSGFQKAKKH
ALPNSNSAAITDCLLEESSPKLPRQSPGAQSKDLLRQGSKFRREISTILIELGFQIKKKT
KRLCINKASIWNSALDGFRNQNFNPLYTIEVVYVNEDDPFGREHPGSKQEFLSLLMQHLE
NSSLFEGSLSKNLSLNSQAVKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYGPEN
TQPILDDVSDFDVAQIIIRINTATNMADLNSVINECYNYLELIGCQRLATTLSDKYMLAK
DILVYHVIKRVQTPFESFKQGLKTLGVLEKIQAYPEAFCNILCKKPENLSAKILSDLFTV
HTIPGVQALGFWNSYLETVEDGKSTTTLEDILLFATGCSSIPPAGFKPAPSIECLPVDFP
IGNKCNNCLALPITNTYKEFQENMDFAIRNTLRLEKEESSHYIGH
Download sequence
Identical sequences G1STW3
9986.ENSOCUP00000006765 ENSOCUP00000006765 XP_002718165.1.1745 XP_008267683.1.1745 XP_008267684.1.1745 XP_008267685.1.1745 XP_008267686.1.1745 XP_008267687.1.1745 XP_008267688.1.1745 ENSOCUP00000006765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]