SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000006859 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000006859
Domain Number 1 Region: 35-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.89e-36
Family SCAN domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 444-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 389-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 350-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 229-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000129
Family KRAB domain (Kruppel-associated box) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000006859
Sequence length 548
Comment (Oryctolagus cuniculus)
Sequence
MLKERPGMAEEPQQQAGVPVVKLEKELPWGRGREDSSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRRWLRPELHTKEQILELLVLEQFLTILPREFYAWVWEHGLESGKALVALVEGL
TERTERTLDAKAVPCHVQAEQEETALCSSTWESGVHPAPVEVKPEWGLPPGEGVRGLDPS
TEEQHLSQDPGGGTQAFQEQVLPMLPAGAGLPAVNTREQEMAAGFLTPGSQGLGTFKDMA
MTFPEEEWRHVTPAQIDCFGEYVEPQACGVSPGLGSKEKEAKPQQEDVKEAFAGLTAERF
GDSALQGPGLGRASEQEPGGSAGCLPGLPPPQQGAAPLPDDLKAHGSFWKPFQCRECGKG
FSRSSNLVRHQRTHEEEKSYGCVECGKGFALREYLLKHQRTHLGKRPYVCSECWKTFSQR
HHLEVHQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAV
HRRAHTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKT
QHRQEPPV
Download sequence
Identical sequences ENSOCUP00000006859 9986.ENSOCUP00000006859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]