SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000008053 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000008053
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.88e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0047
Further Details:      
 
Domain Number 2 Region: 313-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000117
Family FAD/NAD-linked reductases, N-terminal and central domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000008053
Sequence length 533
Comment (Oryctolagus cuniculus)
Sequence
MAGKRVAVIGAGASGLACIKCCLEEGLEPVCFERTDDIGGLWRFQESPDEGRASIYKSVI
INTSKEMMCFSDYPIPDHFPNFMHNSQVLEYFRMYAKEFGLLKYIQFKTTVCSVKKRPDF
STSGQWEVLTECEGKKESAVFDGVLVCTGHHTSAHLPLESFPGIEKFKGQYLHSRDYKNP
EKFTGKRVIVIGIGNSGGDLAVEISHTAKQVFLSTRRGAWIMNRVGDHGYPIDILLSSRF
SQFLKKITGETIANSFLERKMNQRFDHAMFGLKPKHRALSQHPTVNDDLPNRIISGSVKI
KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFSFPFLEDSVKVVKNKVSLYKKVFPPN
LEKPTLAIIGLIQPLGAIMPISELQARWATLVFKGLKTLPSQSEMMTEISQVQEKMAKRY
VESQRHTIQGDYIETMEEIADLVGVRPNLLSLAFTDPRLALQLLLGPCTPVHYRLQGRGK
WDGARKTILTVEDRIRKPLMTRVTESSNSVTSMMSMGKFMLAIAFLAIAVVYF
Download sequence
Identical sequences G1SX06
XP_017200974.1.1745 ENSOCUP00000008053 9986.ENSOCUP00000008053 ENSOCUP00000008053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]