SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000008832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000008832
Domain Number 1 Region: 38-313
Classification Level Classification E-value
Superfamily L domain-like 2.11e-56
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 235-475
Classification Level Classification E-value
Superfamily L domain-like 2.38e-40
Family Ngr ectodomain-like 0.0049
Further Details:      
 
Domain Number 3 Region: 538-840
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.93e-28
Family Rhodopsin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000008832
Sequence length 955
Comment (Oryctolagus cuniculus)
Sequence
MPSPAELRALWLCAALCVSPSAAAACPAPCHCQEDGIMLTADCSELGLCAVPGDLDPLTA
YLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLCSLKILMLQNNQLRGV
PAEALRELPSLQSLRLDANLISVVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQ
AMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNELQEF
PVAIRTLGRLQELGFHNNNIKAIPEKAFVGNPLLQTIHFYDNPIQSVGRSAFQDLPKLHT
LSLNGATDIQEFPDLKGTTSLETLTLTRAGIRLLPPGLCQQLPRLRVLELSHNQIEELPS
LHRCQKLEEIPSGLQHNRIWEIRADTFSQLSSLQTLDLSYNAIRSIHPEAFSTLRSLVKL
DLTDNQLTALPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCCAYGVCAS
FFKASGQWEVQDLHLDDEEAPKRPLGLLAGPAESHYDLDLEELQLEMEDSKPHPSVQCSP
VPGPFKPCEHLFESWGVRLAVWAIASLSVLCNGLVLLTVFAGGPAPLPPVKFVTGAIAGA
NALTGISCGLLASVDALTFGQFAEYGARWEMGLGCRATGFLAVLGSEASVLLLTLAAVQC
SISVSCVRAYGKAPSPGSVRAGALGCLMLAGLAAALPLASVGDYGASPLCLPYAPAEGQP
AALGFAVALVMMNSFCFLVVAGAYIKLYCDLPRSDLEAVWDCAMVRHVAWLIFADGLLYC
PVAFLCVASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRRLWPCTGS
PGSLACAAARELEKSSCESTQALVAFSDVDIVLDASEAGRPPGLETYGFPSVTRVPCQQP
GAPSLESSHCAEPEGPCSGKPPPTVDGELLLKAEGAPPPPGRAFRHSSGAFGSHV
Download sequence
Identical sequences G1SYX1
ENSOCUP00000008832 9986.ENSOCUP00000008832 ENSOCUP00000008832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]