SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000010737 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000010737
Domain Number 1 Region: 107-154
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000536
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000589
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000010737
Sequence length 297
Comment (Oryctolagus cuniculus)
Sequence
LGFPGSYRGRGSQKSRHLPPGVCGCRRRPAALAMRTMWMALCALARLWPGALGGCAEAGR
CCPGRDPACFVRGWRLDRVFGTCFCDQACRLTGDCCFDYARACPARPCSVGEWSPWSACA
DQCKPTTRVRTRSVQQEPQNGGAPCPPLEERAGCLEYSTPQGQDCGHAFVPAFITTSAFN
KERTRPAASPHWATRTEDAGYCMEFKTESLTPHCALENRPLTRWMQYLREGYTVCVDCQP
PAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences ENSOCUP00000010737 9986.ENSOCUP00000010737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]