SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000010977 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000010977
Domain Number 1 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.29e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 479-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 171-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000010977
Sequence length 539
Comment (Oryctolagus cuniculus)
Sequence
GRLTFRDVAIDFSQEEWKCLDPDQRALYRDVMLENYKNLVSLGISPTCVVKEICPKGDSN
TGEIFQTLSLERNERNDVKDFSPREVQKNQNDFEFQWNNDEGNLNDLFIIHKENLISRRD
QHDRKDARSSVLKTCLGSSFQSHLPELQIFPSESEIDECNYIEQSINNREKPYKCNECGK
VFSSHSNLNTHQIIHRGEKPYKCYECGKVFTQNSHLANHRRIHTGEKPYKCNECGKAFSV
YSSLTTHQAIHTGEKPYKCNECGKVFTQNSHLASHRGIHTGEKPYKCDECGKFFSQTSNL
ARHLRVHTGEKPYKCNECGKSFSVRSNLIAHQVIHTGEKPYKCSECGKVFSQTSSLAIHR
RIHTGEKPYKCNECGKAFSSHSNLNTHQIIHRGEKPYKCNDCGKVFTQNSHLVNHQRIHT
GEKPYKCNVCGKAFSVYASLTTHQVIHSGEKPYKCNECGKVFTQNSHLASHRRIHTGEKP
YKCNKCGKAFSVSSSLTTHQLVHTGEKPYTCNECGKVFGRRSNLASHQRIHTGLLKAYK
Download sequence
Identical sequences ENSOCUP00000010977 9986.ENSOCUP00000010977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]