SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000012738 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000012738
Domain Number 1 Region: 496-587
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.53e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 365-536
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000012738
Sequence length 680
Comment (Oryctolagus cuniculus)
Sequence
XLLLRGSSPGGALRTRTSSPLSGSSCCCCCSSRRGSQLSVSELTPSSHASARRQQPAPQP
APAAQSPLCLRLQLAASPTGSLGSLGSGPPLAHHHHHHHHQHPAPHQHPAPQARRESNPF
TEIAMSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPAPGAGGASSPCAAAAASSP
APEIVVSKPEHNNSNNLALYGAGGGGGPKPSKKKNQNIGYKLGHRRALFEKRKRLSDYAL
IFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTVILLGLIIVYHAREIQLFMVD
NGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILS
IPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSI
SLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTG
IMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKL
VKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNER
SEDFEKRIVTLETKLETLIGSIQALPGLLSQTLRQQQRDFLEAQLEARDKHGPYEAARSR
SSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences ENSOCUP00000012738 9986.ENSOCUP00000012738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]