SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000012767 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000012767
Domain Number 1 Region: 727-1079
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.52e-54
Family Ankyrin repeat 0.0000472
Further Details:      
 
Domain Number 2 Region: 221-409,440-521
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.31e-45
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 438-711
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.07e-43
Family Ankyrin repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 1104-1163
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 
Domain Number 5 Region: 48-127,162-192
Classification Level Classification E-value
Superfamily POZ domain 0.000000000235
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000012767
Sequence length 1169
Comment (Oryctolagus cuniculus)
Sequence
SLAEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCTLLAAQANKESTNESFISRLLTIVAD
LYEQEQYSDLKIKVGDRHISAHKFVLAARSDSWSLANLASTKELDLSVLNSEVTVTLKKW
LKTKQLRYYASQVYLQVVLNLTRTEQGNILMKRCEKGVMSLVNVRNCIRFYQTAEELNAS
TLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIE
MDSQLPGKLNEVDHNGDLALDLALSRRLESIATTLVSHKADVDMVDKNGWSLLHKGIQRG
DLFAATFLIKSGALVNAATLGAQETPLHLVALYSSKKHSAGVMSEMAQIAEALLQAGANP
NMQDSKGRTPLHLSIMARNEHVFSQLLLCKQLDLELKDHEGSTALWLAVQSITMSSDQSV
NPFEDLPVVNGTSFDENSFAARLIQRGSNTDAPDAMTGNCLLQRAAGAGNEAAALFLATN
GAHVNHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEAVPLPKEAASLAGSADS
VSLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTG
MHTIAAQLLGSGASINDSMSSGQTLLHMAIQRQDSKSALFLLEHQADINIRTQDGETALQ
LAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGPG
PSGCLQTLLHRAIDENNEATACFLIRSGCDVNSPRQPGASGEGEEEARDGQTPLHLAASW
GLEETVQCLLEFGANVNAQDAEGRTPVHVAISNQHGVIIQLLISHPDIHLNVRDRQGLTP
FACAMTYKNNKAAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSR
VQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELNKHRQTALHLAAQQDLPTICSVLLE
NGVDFAAVDENGNNALHLAVTHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKEN
AAAIFDLFLECMPEYPLDKPDAEGNTVLLLAYMKGNANLCRAIVRAGARLGVNNNQGVNI
FNYQVATKQLLFRLLDMLSKEPPWCDGSNCYECTAKFGVTTRKHHCRHCGRLLCHKCSTK
EIPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences ENSOCUP00000012767 9986.ENSOCUP00000012767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]