SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000013172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000013172
Domain Number 1 Region: 49-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.05e-38
Family SCAN domain 0.0000482
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 222-279
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000327
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 
Domain Number 6 Region: 355-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000381
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000013172
Sequence length 563
Comment (Oryctolagus cuniculus)
Sequence
MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSSLQETPPPDPEVFRQRFR
RFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQLWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGVVPLDPVQESSSFDLHHKAPQSHF
KQSSRKPRLLQSRALPATHVPAPPHDGSPREQAMASALLTADSQAMVKIEDMAVSLILEE
WGCQNLARRNLNRDNRQENYGNTFSQGCENRNENEESTSKAEVREDSASRGETAGRFQKE
FGEKREQLGKVVERQQRNPEEKNGKEKRDSGPTTVKEKKTTPGERGPREKGKGLGRSFSL
SSNFNTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHA
RERAPEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences G1T976
9986.ENSOCUP00000013172 ENSOCUP00000013172 XP_002721906.1.1745 XP_008247124.1.1745 XP_008247125.1.1745 XP_017193347.1.1745 ENSOCUP00000013172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]