SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000013239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000013239
Domain Number 1 Region: 39-213
Classification Level Classification E-value
Superfamily PH domain-like 9.43e-58
Family Phosphotyrosine-binding domain (PTB) 0.000000178
Further Details:      
 
Domain Number 2 Region: 381-488
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-26
Family SH2 domain 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000013239
Sequence length 496
Comment (Oryctolagus cuniculus)
Sequence
XGSCSAPSLDARTASAAPRPAAVSMSASRKGRPGDEPLPRPRGAPHASDQVLGPGVTYVV
KYLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGAKGAFRKRKPPSKMLSSILGKSN
LQFAGMSISLTVSTASLNLRTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNR
RACHILECCDGLAQDVIGSIGQAFELRFKQYLQCPSKIPVLQDRMQSLDEPWTEEEGEGS
DHPYYNSVPSKMPPPGGFLDARLKNRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQAP
VRQGSLDIYSTPEGKPHMAPAGEAPTYVNTQRMPPQAQPAATSSAESSPRRDLFDMKPFE
DALKNQSLGPVLNKAASVECISPVSPRAPDAKMLETLQAEPWYQGEMSRKEAEGLLEKDG
DFLVRKSTTNSGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSVPI
VSAGSELCLQQPVERR
Download sequence
Identical sequences G1T9D4
ENSOCUP00000013239 9986.ENSOCUP00000013239 ENSOCUP00000013239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]