SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000013263 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000013263
Domain Number 1 Region: 112-175
Classification Level Classification E-value
Superfamily RING/U-box 1.18e-17
Family ZZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 389-438
Classification Level Classification E-value
Superfamily UBA-like 2.35e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 3 Region: 44-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000701
Family PB1 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000013263
Sequence length 442
Comment (Oryctolagus cuniculus)
Sequence
MASLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAEAAAGPGPCERLLARVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMCYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCGACEAKGLHQEHSKLAFPSPFGHLEGFSH
SRWLRKLRHGHFGWPGWEMGPPGNWSPRPPRAGEARPSCAAESEIKASGPSEDPNVNFLK
NVGESVAAALSPLGIEVDIDVEHGGKRSRLTPASPESSSTEEKCSSQPSSCSSEPSKGDG
NSEGTAQSLAEQMKKIALETGAQPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQM
PGSEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQ
TKNYDIGAALDTIQYSKHPPPL
Download sequence
Identical sequences 9986.ENSOCUP00000013263 ENSOCUP00000013263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]