SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000014122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000014122
Domain Number 1 Region: 34-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.25e-38
Family SCAN domain 0.0000514
Further Details:      
 
Domain Number 2 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 389-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 305-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 474-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 6 Region: 203-246
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000549
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000014122
Sequence length 532
Comment (Oryctolagus cuniculus)
Sequence
ASTWDSQSRKERDEVLEVKIEEEEASAPGSPAPGPERSRQRFRGFRYPEAAGPREALSRL
RELCRQWLRPDLHSKEQILELLVLEQFLTILPGDLQRWVRKQRPESGEEVVALLEYLERQ
LEEPPPQVPAGDQGQEPLCCKMVLLTPAQGLQSSQFQQIKFLLKHESLEPQPSQNRVLQV
PELAQGGSCGEDKVVGARLTPESQGFLKMEDVAQTASPGWKQLNSSQMHLCRDEIQENCD
SLLPPGADTQTKVRDLPPAEPHAEQEPGQTPGHLGGDTAQITTGAQAGELEGRLQRKPRN
ASGRRQHICLECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIGSSALIIHQRVHTGE
KPYECEECGKVFSHSSNLIKHQRTHTGEKPYECEDCGKTFSQSCSLLEHHKIHTGEKPYQ
CNLCGKAFRRNSHLLRHQRIHGDKSNQKPEHGEAWECQSRVEGQWENVETPVSYKCSECE
RSFTWNRSLLEHQKIHTGEKPYQCDMCGKGFTRTSYLVQHQRSHVGKRIPSQ
Download sequence
Identical sequences ENSOCUP00000011053 9986.ENSOCUP00000014122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]