SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000014172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000014172
Domain Number 1 Region: 194-344
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0028
Further Details:      
 
Domain Number 2 Region: 71-168
Classification Level Classification E-value
Superfamily ISP domain 3.14e-26
Family Rieske iron-sulfur protein (ISP) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000014172
Sequence length 344
Comment (Oryctolagus cuniculus)
Sequence
MGGCFSKPKPVELKIEVVLPEKERSKEELVASGKGSPRTYQGNGTARHFHAEEHLPAPHP
YPGPQDCVEAAVCHVKDLENSQMREVELGWGKVLLVKDGGEFHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQMQRRTKM
MAKCISPSAGHSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSK
SLDAQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSS
PKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNAVVVGAGFLG
Download sequence
Identical sequences G1TBQ8
ENSOCUP00000014172 ENSOCUP00000014172 9986.ENSOCUP00000014172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]