SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000015854 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000015854
Domain Number 1 Region: 11-107
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 127-233
Classification Level Classification E-value
Superfamily Immunoglobulin 2.68e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 253-340
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 1352-1446
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-19
Family I set domains 0.053
Further Details:      
 
Domain Number 5 Region: 1622-1707
Classification Level Classification E-value
Superfamily Immunoglobulin 5.06e-19
Family I set domains 0.05
Further Details:      
 
Domain Number 6 Region: 1814-1896
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 7 Region: 1165-1265
Classification Level Classification E-value
Superfamily Immunoglobulin 9.74e-16
Family I set domains 0.023
Further Details:      
 
Domain Number 8 Region: 799-893
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000169
Family I set domains 0.011
Further Details:      
 
Domain Number 9 Region: 981-1076
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000127
Family I set domains 0.033
Further Details:      
 
Domain Number 10 Region: 891-986
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000134
Family I set domains 0.025
Further Details:      
 
Domain Number 11 Region: 1072-1158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000395
Family I set domains 0.044
Further Details:      
 
Domain Number 12 Region: 334-429
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000185
Family I set domains 0.023
Further Details:      
 
Domain Number 13 Region: 726-812
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000511
Family I set domains 0.015
Further Details:      
 
Domain Number 14 Region: 1712-1804
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000107
Family I set domains 0.0048
Further Details:      
 
Domain Number 15 Region: 1451-1536
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000192
Family I set domains 0.014
Further Details:      
 
Domain Number 16 Region: 1260-1348
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000258
Family I set domains 0.024
Further Details:      
 
Domain Number 17 Region: 1544-1629
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000108
Family I set domains 0.0047
Further Details:      
 
Domain Number 18 Region: 516-605
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000326
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 19 Region: 434-543
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000144
Family I set domains 0.0071
Further Details:      
 
Weak hits

Sequence:  9986.ENSOCUP00000015854
Domain Number - Region: 620-717
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00044
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000015854
Sequence length 1897
Comment (Oryctolagus cuniculus)
Sequence
MKAGSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPTVVWEKGGQQLAASERLSF
PADGAEHGLLLSGALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPAPEPEPPLAERPLPP
PGTGEGAPVFLTGPRSQWVLRGAEVVLTCQVGGLPEPTLYWEKDGMALDEVWDSSHFVLE
RGCAEGGQGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPPEGADE
EPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRD
GGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFARPLQDVEGREHGIAV
LECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGVYLCEMRGRVR
TVANVTVKGPILKRLPRKLDVLEGENAVLLVETREAGVEGRWSRDGEELPATCQSSCGHM
HALVLPGVTREDAGEVTFSLGSSRTTTLLRVKCVKHSPPGPPVLAEMFKGHKNTVLLTWK
PPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRVCTVSEHG
RSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKANEP
EGQVEPGALRYRMEQKGLQHRLILRAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILS
PQEKVSLTFTTSERVVLTCELSRADFPATWYKEGQKVEESESLVVKMDGRKHRLILPEAK
VVDSGEFECRTEGVSAFFSLTVQDPPVHIVDPREHVFVHAITSECVMLTCEVDQEDAPVR
WYKDGQEVEESALVVLENEGPRRRLVLPTAQPPDGGEFQCVAGEERAYFTVTITDVSSWI
VYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTTRRLVLPA
VQLEDSGEYRCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVSLECVVLMCELSREDAP
VRWYKDGLEVEESEALVLESDGPRRRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPE
RIVHPAARSLDLQFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLT
LPHAQPEDAGEYVCETRDEAVTFNVSLAEPPVQFLAPEAAPSPLHVAPGEPVVLSCELSR
AGAPVFWSHNGKPVQEGEGVELRAEGPRRALCILAADLAHTGLYTCQCGAEPGAPSLSFT
VQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQ
AGARQVLRVRGARSGDAGEYLCDAPQDSRIFLVSVEEPPPVKLVSELTPLTVHEGDDATF
RCEVSPPEADVTWLRNGAVVTPGPQLQVAQSGSSRSLTVRGCRLEDAGTVTARAGATTTS
ARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGEPLPLDSRLCVA
QEGHIHRLVIRGVVLADQGTYGCESHHDRTLARLSVRPRQLRALQPLEDVTVSEGGSATF
QLELSQEGMTGEWARGGVRLQPGPKCHIHAEGRTHRLALSGLGLADSGCISFTADSLRCA
ARLTVREIPVTFVRGPQDLEVMEGDTATLECELSQTLADVTWEKDGRALTASPRLRLQAL
GTRRLLQLRRCSPSDAGTYSCAVGTARTGPARLTVRERTVSVLCELRAVRAREGDGATFE
CTVSEAETTGSWELGGRPLRPGGRVRIRQEGKKHILVLSELRTEDAGEVRFQAGPAQSLT
LLEVEALPLQMCRRPPREKTVLVGRRAVLEVTVSRSGAHVCWSREGTELCPGDKYEMRSH
GPTHSLVIRDVRPEDQGTYCCQAGQDSAHTRLLVEGE
Download sequence
Identical sequences ENSOCUP00000016023 9986.ENSOCUP00000015854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]