SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000018326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9986.ENSOCUP00000018326
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00379
Family KRAB domain (Kruppel-associated box) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000018326
Sequence length 127
Comment (Oryctolagus cuniculus)
Sequence
MLSRNVLLQVLVSLLSLGYCITKPEVIFKLEQGAEPWIVEGPLSPSLPAVQKMDNLIKAS
QESQDGYISQAATTNNNTSTEERIELGKALHLSSNNIPKLNTKSGSYSGLRPEAFNLYKN
AIHPSEP
Download sequence
Identical sequences ENSOCUP00000018326 9986.ENSOCUP00000018326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]