SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000018789 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000018789
Domain Number 1 Region: 329-403
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000883
Family Rhamnogalacturonase B, RhgB, middle domain 0.02
Further Details:      
 
Domain Number 2 Region: 127-202
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000165
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 964-1053
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000432
Family Carboxypeptidase regulatory domain 0.021
Further Details:      
 
Domain Number 4 Region: 883-955
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000765
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  9986.ENSOCUP00000018789
Domain Number - Region: 215-299
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00179
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 810-868
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0051
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 442-491
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00549
Family Carboxypeptidase regulatory domain 0.017
Further Details:      
 
Domain Number - Region: 51-114
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0322
Family Cna protein B-type domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000018789
Sequence length 1222
Comment (Oryctolagus cuniculus)
Sequence
XVVRGGSGPVCGGVVAAVAVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTNVELYVDGVNDICTKGG
DINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRSTGTEAKIQSTVTQPGGKFAFFKVLPGD
YEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSS
LVTKEDVLGCSVSPVPGFQPPDESLVYLCYAVSKEDGSFSFYSLPSGDYTVIPFYRGERI
TFDVAPSRLDFTVEHDSLRIEPVFHVMGFSVTGRVLNGPEGEGVPEAVVTLNSQIKVKTK
ADGSFRLENITTGTYTIQAHKDHLYFDTVTIKIAPNTPQLADIIATGFSVCGQISILRFP
DTVKQMSKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGSYKVQVLVPEAESRAGLTLK
PHVFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQALSRQGEKRSLQLSGKV
NSMTFTFDNVLPGKYKVSIVHEDWCWKNKSVEVEAVEEDVAAVEFRQTGYMLRCSLSHAI
TLEFYQDGNGPENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILT
LTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAQIETRRQE
REKNGKEEGGEGSTKPPVQEMVEELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSME
AVVSGESCPGKLIEIQGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDRGAYSV
GPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGG
VFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLRITITGYRTA
YSCYGTVSSLNGEPEQGVAVEAVGQKDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKA
EGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
DNLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYGLPQVSFAAVGYHKH
VTLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQA
ASDNSGPEDVKRQAKKQKTRRT
Download sequence
Identical sequences G1TP59
ENSOCUP00000018789 ENSOCUP00000018789 9986.ENSOCUP00000018789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]