SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000021984 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000021984
Domain Number 1 Region: 40-164
Classification Level Classification E-value
Superfamily POZ domain 2.25e-25
Family BTB/POZ domain 0.004
Further Details:      
 
Domain Number 2 Region: 348-591
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-24
Family Kelch motif 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000021984
Sequence length 674
Comment (Oryctolagus cuniculus)
Sequence
MQSREDAPRSRGLASPGGRGPEKFEKRTVSAFLRGPQELQDSAHSAAPLAQLRSFCDSRL
LCDVTTEVVSPGCGPGSGRLFPCNRNMLATSCPYFQSMFTGGTCESQQASVTMHGVDAES
FEALLEYCYTGCVSLSEANAQGLFASSDVLQLEYVREASASFLASLDLANCTAIFKFANT
FGHAKLRSQAQSFIAHDFKQLSRMGSVPEETADRTLAQLLAILGLDSLNTESEQVVGHVA
LKWIEAGPKERGPSAVEVFKCVRWTLFTKDEQDYLEGLLAKPTVKKYCLDVIVKALWMRY
GDMQMSLVPMPDSTSNASSSVVSAGENPLQRLGVCAKEMVILFGRPKDPFICCPYSGDIY
KVPSPLTCLALTGAVVTFTVCISPDHDIYLAAQSRKELWVYTPAQNSWQQLPDHLLCHEG
MTITYLRGYIYILGGRDPITGVKLKKVECYSVQQWVLVASLPHSFMSFDLIISRNLYTLN
SKRMYHYDPSHNVRLKCLSVKRSNFHEACVFNDEIYCICDLPVMKIYNPFRAHWRQINNI
PMVAETNNHRIISHGQKLLLITSRNSGWKKNQVTVYEYDTTEDRWINIGTPLGLLQFDSY
FFCLSAQVYPCCLEPGQSFLTEEDDIPSESSTEWDSGGFNELGSEPSSSSSMADEDLWQE
LSPVVKAKDTSMSI
Download sequence
Identical sequences G1TY25
ENSOCUP00000021984 ENSOCUP00000021984 9986.ENSOCUP00000021984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]