SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000022109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000022109
Domain Number 1 Region: 129-207
Classification Level Classification E-value
Superfamily DEATH domain 0.000000412
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000022109
Sequence length 216
Comment (Oryctolagus cuniculus)
Sequence
MGLRTTKQMGRGTKQPAGHQEDHMAKEPVEDTDPSTLSFNMSDKYPIQDTGLPKAEECDT
VTLNCPPNSDEQHQGEENGFPDSTGDPLSDVSKDKPCHENCTCSSCSLRAPTISDLLNDQ
DLLDVIRIKLDPCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLLRNSQRTVGQL
MELCRLYHRADVEKVLRRWVEEEWPKRERGDYSRHF
Download sequence
Identical sequences G1TYE5
XP_017203201.1.1745 ENSOCUP00000022109 9986.ENSOCUP00000022109 ENSOCUP00000022109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]