SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000022369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000022369
Domain Number 1 Region: 418-531
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-32
Family SH2 domain 0.000000675
Further Details:      
 
Domain Number 2 Region: 97-189
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-30
Family Ras-binding domain, RBD 0.00000671
Further Details:      
 
Domain Number 3 Region: 232-345
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000107
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000022369
Sequence length 534
Comment (Oryctolagus cuniculus)
Sequence
MELDLSPPQLSSSPEDLCPVPGTPPGTPPLPDASLPGEVKRSQPLPIPPSRRLREEGLQA
SSLPSIPNPFPELCSPPSQAPILGGSASARGLLPRDTSHVVKVYSEDGACRSVEVAAGAT
ARHVCEMLVHRAHALNDENWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRK
HFAKYELFKSSPHSLFPEKMVSSCVDAHAGVSHEDLIPGGGPRNFLNAGSFPEIQGFLQL
RGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTD
FGFCIKPNKLRSGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLRPPY
LGSPPLRSVSDNTLVAMDFSGHAGRVIENPREALSAALEEAQAWRKKTNHRLSLPTPCSG
TSLSAAIHRTQPWFHGRISREESQQLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVK
HYLILPSEEEGCLYYSMDDGHTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
Download sequence
Identical sequences G1TZ49
ENSOCUP00000022369 ENSOCUP00000022369 9986.ENSOCUP00000022369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]