SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000025543 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000025543
Domain Number 1 Region: 305-407
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 42-148
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Domain Number 3 Region: 416-530
Classification Level Classification E-value
Superfamily SRCR-like 1.24e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 4 Region: 185-283
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000025543
Sequence length 753
Comment (Oryctolagus cuniculus)
Sequence
MRPVGVWQWSPWGLLLCLLCSSGWGSPSPSASPEKRPGSEGLRFRLAGYPRKPSEGRVEI
QRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCSGTEQS
VTECASRGWGNSDCTHDEDAGVICKDERLPGFSDSNVIEVEHQLQVEEVRLRPAVGWGRR
PLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNTAFYRLLAQRQQHS
FGLHGVACLGTEAHLSLCPLEFYRANDTARCPGGAPAVVSCVPGPLYTASSSQKKQQQSK
PQGEARVRLKGGAHPGEGRVEVLKAGTWGTVCDRKWDLQAASVVCRELGFGSAREALSGA
RMGQGMGAIHLSEVRCSGQEPSLWKCSHKNITAEDCSHSQDAGVRCNLPYTGVETKIRLS
GGRSRHEGRVEVQTGGSGPPRWGLICGDDWGTLEAMVVCRQLGLGYANHGLQETWYWDSG
NITEVVMSGVRCTGTELSLDQCAHHSTHISCKRPGTRFTAGVICSETASDLLLHSALVQE
TAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHS
WVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQ
GITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGH
RIWVHNCHIGDAFSEEANRRFERYPGQTSNQIV
Download sequence
Identical sequences ENSOCUP00000025543 9986.ENSOCUP00000025543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]