SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000000045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000000045
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.06e-50
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000000045
Sequence length 197
Comment (Tetraodon nigroviridis)
Sequence
KIIEKYLKMTSGGYRSPKILNVWEVDRETEGERFGENDGLENRRLLWHGTNIAVVAAILK
SGLRIMPHSGGRVGRGIYFASENSKSAGYALAVRTSKNTGVMFLCEVALGKENTITKDNP
SLKKAPAGFDSVVARGSVEPDPTKDTFITLNGRKVWVPQGKPVDQPQYADSHFSNSEYLI
YKESQCRIRYLLELQMH
Download sequence
Identical sequences H3BVN3
99883.ENSTNIP00000000045 ENSTNIP00000000045 ENSTNIP00000000045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]