SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000000178 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000000178
Domain Number 1 Region: 89-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000391
Family Laminin-type module 0.0022
Further Details:      
 
Domain Number 2 Region: 42-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family Laminin-type module 0.029
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000000178
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0024
Family Laminin-type module 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000000178
Sequence length 147
Comment (Tetraodon nigroviridis)
Sequence
NCRDHSTGNFCERCEDGYIMTPGPLGRHSCKPCACPLSVASNNFAVYCDRGGDILRCKCQ
DGYAGHFCERCAPGYYGNPMTIGNSCKRCDCNGNSDPNLIVNECHNVTGHCQHCWGNTAG
AKCERCAPGFYGDAIVTKNCQECKKNK
Download sequence
Identical sequences H3BW16
ENSTNIP00000000178 99883.ENSTNIP00000000178 ENSTNIP00000000178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]